General Information

    • DRAMP ID

    • DRAMP00498

    • Peptide Name

    • Putative defensin-like protein 42 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • MNWELCDDYPSKAPPETCNKVDGARRCRTSCNNEGYGGANCNLKGKVKVCECTILRVCLPHHKRPPHVPKPPK

    • Sequence Length

    • 73

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00498 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00498.

Physicochemical Information

    • Formula

    • C347H559N109O101S9

    • Absent Amino Acids

    • FQ

    • Common Amino Acids

    • PCK

    • Mass

    • 8162.47

    • PI

    • 9.02

    • Basic Residues

    • 16

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +9

    • Boman Index

    • -171.16

    • Hydrophobicity

    • -0.882

    • Aliphatic Index

    • 50.68

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 124.72

    • Polar Residues

    • 26

DRAMP00498

DRAMP00498 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds (By similarity).

    • Caution

    • Could be the product of a pseudogene. Lacks the signal peptide, which is a conserved feature of the family.

Literature Information

  • ·Literature 1

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 2

    • Title

    • Structural analysis of Arabidopsis thaliana chromosome 3. II. Sequence features of the 4,251,695 bp regions covered by 90 P1, TAC and BAC clones.

    • Reference

    • DNA Res. 2000 Jun 30;7(3):217-221.

    • Author

    • Kaneko T, Katoh T, Sato S, Nakamura A, Asamizu E, Tabata S.