General Information

    • DRAMP ID

    • DRAMP00510

    • Peptide Name

    • Defensin-like protein 54 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • ESVIEPAKYGACLFLCDARRDDHACFYDCTNVAIYRTGHCVGNPPRCCCIRG

    • Sequence Length

    • 52

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00510 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00510.

Physicochemical Information

    • Formula

    • C245H378N74O73S8

    • Absent Amino Acids

    • MQW

    • Common Amino Acids

    • C

    • Mass

    • 5784.63

    • PI

    • 6.93

    • Basic Residues

    • 8

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +2

    • Boman Index

    • -94.48

    • Hydrophobicity

    • -0.096

    • Aliphatic Index

    • 63.85

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 97.45

    • Polar Residues

    • 20

DRAMP00510

DRAMP00510 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Functional annotation of a full-length Arabidopsis cDNA collection.

    • Reference

    • Science. 2002 Apr 5;296(5565):141-145.

    • Author

    • Seki M, Narusaka M, Kamiya A, Ishida J, Satou M, Sakurai T, Nakajima M, Enju A, Akiyama K, Oono Y, Muramatsu M, Hayashizaki Y, Kawai J, Carninci P, Itoh M, Ishii Y, Arakawa T, Shibata K, Shinagawa A, Shinozaki K.
  • ·Literature 2

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 3

    • Title

    • Whole genome sequence comparisons and full-length cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.

    • Reference

    • Genome Res. 2004 Mar;14(3):406-413.

    • Author

    • Castelli V, Aury JM, Jaillon O, Wincker P, Clepet C, Menard M, Cruaud C, Qu©tier F, Scarpelli C, Schächter V, Temple G, Caboche M, Weissenbach J, Salanoubat M.