• DRAMP ID

    • DRAMP00519
    • Peptide Name

    • Putative defensin-like protein 64 (Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • ERIDICFIPCTRRYGDYECWFDCTYNRYKEGGCVEDVVVKHNRNRPTFRAVELCFFSIKFMYDFSMK
    • Sequence Length

    • 67
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00519 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00519.
    • Formula

    • C368H544N98O101S8
    • Absent Amino Acids

    • Q
    • Common Amino Acids

    • FRC
    • Mass

    • 8213.44
    • PI

    • 7.83
    • Basic Residues

    • 12
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 19
    • Net Charge

    • +2
    • Boman Index

    • -159.08
    • Hydrophobicity

    • -0.422
    • Aliphatic Index

    • 52.24
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 13325
    • Absorbance 280nm

    • 201.89
    • Polar Residues

    • 22

DRAMP00519

DRAMP00519 chydropathy plot
    • Caution

    • Could be the product of a pseudogene. Lacks 2 of the 4 disulfide bonds, which are conserved features of the family.
  • ·Literature 1
    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.
    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.
    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.