General Information

    • DRAMP ID

    • DRAMP00522

    • Peptide Name

    • Defensin-like protein 68 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • YDLFSEIGISAATLVIPTCFENCNATFQDPECNKWCALLAYKDGSCLYPPSEVDDLPPIKRPYIPRCCCNPITLSPPSP

    • Sequence Length

    • 79

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00522 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00522.

Physicochemical Information

    • Formula

    • C390H594N94O117S8

    • Absent Amino Acids

    • HM

    • Common Amino Acids

    • P

    • Mass

    • 8728.05

    • PI

    • 4.36

    • Basic Residues

    • 5

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 24

    • Net Charge

    • -4

    • Boman Index

    • -76.19

    • Hydrophobicity

    • -0.051

    • Aliphatic Index

    • 77.85

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 11960

    • Absorbance 280nm

    • 153.33

    • Polar Residues

    • 28

DRAMP00522

DRAMP00522 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 2

    • Title

    • Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.

    • Reference

    • Plant Biotechnol J. 2006 May;4(3):317-324.

    • Author

    • Underwood BA, Vanderhaeghen R, Whitford R, Town CD, Hilson P.
  • ·Literature 3

    • Title

    • Experimental validation of novel genes predicted in the un-annotated regions of the Arabidopsis genome.

    • Reference

    • BMC Genomics. 2007 Jan 17;8:18.

    • Author

    • Moskal WA Jr, Wu HC, Underwood BA, Wang W, Town CD, Xiao Y.