General Information

    • DRAMP ID

    • DRAMP00530

    • Peptide Name

    • Defensin-like protein 76 (Protein LCR86; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • LCR86

    • Sequence

    • IDVHDAMCYRSECTSVCDQICLSHGYTNGWYCGTFRLHTGCCCLKKKELNQIISPSKN

    • Sequence Length

    • 58

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00530 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00530.

Physicochemical Information

    • Formula

    • C279H436N80O86S9

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • C

    • Mass

    • 6575.56

    • PI

    • 7.72

    • Basic Residues

    • 9

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +4

    • Boman Index

    • -93.59

    • Hydrophobicity

    • -0.274

    • Aliphatic Index

    • 65.52

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10470

    • Absorbance 280nm

    • 183.68

    • Polar Residues

    • 27

DRAMP00530

DRAMP00530 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones.

    • Reference

    • DNA Res. 1999 Jun 30;6(3):183-195.

    • Author

    • Kaneko T, Katoh T, Sato S, Nakamura Y, Asamizu E, Kotani H, Miyajima N, Tabata S.
  • ·Literature 2

    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.

    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.

    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.