General Information

    • DRAMP ID

    • DRAMP00535

    • Peptide Name

    • Defensin-like protein 82 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • RTQEHPCQDYRLGCKSRDVCNAKCLSLGYVKGGDCVTFAFPICCCKINFGFQDDSPISSPIFTD

    • Sequence Length

    • 64

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00535 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00535.

Physicochemical Information

    • Formula

    • C307H472N84O94S8

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • C

    • Mass

    • 7100.11

    • PI

    • 6.7

    • Basic Residues

    • 8

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +1

    • Boman Index

    • -105.62

    • Hydrophobicity

    • -0.184

    • Aliphatic Index

    • 59.38

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 55.24

    • Polar Residues

    • 25

DRAMP00535

DRAMP00535 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Whole genome sequence comparisons and full-length cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.

    • Reference

    • Genome Res. 2004 Mar;14(3):406-413.

    • Author

    • Castelli V, Aury JM, Jaillon O, Wincker P, Clepet C, Menard M, Cruaud C, Qu©tier F, Scarpelli C, Schächter V, Temple G, Caboche M, Weissenbach J, Salanoubat M.