General Information

    • DRAMP ID

    • DRAMP00538

    • Peptide Name

    • Defensin-like protein 85 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • LISDKCTEGCKSTIGCNTRCMMRGGGYCESAKIHGAVKIFCCCNNYSNSPISSPVIN

    • Sequence Length

    • 57

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00538 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00538.

Physicochemical Information

    • Formula

    • C250H408N74O81S10

    • Absent Amino Acids

    • QW

    • Common Amino Acids

    • CS

    • Mass

    • 6067.04

    • PI

    • 8.5

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -74.33

    • Hydrophobicity

    • -0.04

    • Aliphatic Index

    • 61.58

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 62.14

    • Polar Residues

    • 31

DRAMP00538

DRAMP00538 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Functional annotation of a full-length Arabidopsis cDNA collection.

    • Reference

    • Science. 2002 Apr 5;296(5565):141-145.

    • Author

    • Seki M, Narusaka M, Kamiya A, Ishida J, Satou M, Sakurai T, Nakajima M, Enju A, Akiyama K, Oono Y, Muramatsu M, Hayashizaki Y, Kawai J, Carninci P, Itoh M, Ishii Y, Arakawa T, Shibata K, Shinagawa A, Shinozaki K.
  • ·Literature 2

    • Title

    • Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones.

    • Reference

    • DNA Res. 1998 Feb 28;5(1):41-54.

    • Author

    • Sato S, Kaneko T, Kotani H, Nakamura Y, Asamizu E, Miyajima N, Tabata S.