General Information

    • DRAMP ID

    • DRAMP00545

    • Peptide Name

    • Defensin-like protein 95 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • WGKCDLRKGLCRLADTISTCDVPCRAVDSKYHGGECLNVGGGQGICWCCRDYDAAKSGAEKESM

    • Sequence Length

    • 64

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00545 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00545.

Physicochemical Information

    • Formula

    • C286H455N87O93S9

    • Absent Amino Acids

    • F

    • Common Amino Acids

    • GC

    • Mass

    • 6888.83

    • PI

    • 6.71

    • Basic Residues

    • 10

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +1

    • Boman Index

    • -119.64

    • Hydrophobicity

    • -0.402

    • Aliphatic Index

    • 57.97

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14480

    • Absorbance 280nm

    • 229.84

    • Polar Residues

    • 26

DRAMP00545

DRAMP00545 chydropathy plot

Comments Information

    • Function

    • Defense response to fungus.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.