• DRAMP ID

    • DRAMP00547
    • Peptide Name

    • Defensin-like protein 97 (Protein LCR85; Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the DEFL family
    • Gene

    • LCR85
    • Sequence

    • RRVCDSAAGLCSMLFSCNTQCNSLGRNFTGGECSDARFPGLSVCYCCHNVESSAEMESM
    • Sequence Length

    • 59
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00547 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00547.
    • Formula

    • C255H402N78O89S11
    • Absent Amino Acids

    • IKW
    • Common Amino Acids

    • SC
    • Mass

    • 6337.13
    • PI

    • 5.01
    • Basic Residues

    • 5
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 14
    • Net Charge

    • -1
    • Boman Index

    • -107.03
    • Hydrophobicity

    • -0.07
    • Aliphatic Index

    • 47.97
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 34.31
    • Polar Residues

    • 29

DRAMP00547

DRAMP00547 chydropathy plot
    • Function

    • Defense response to fungus.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    • Reference

    • Plant Biotechnol J. 2006 May;4(3):317-324.
    • Author

    • Underwood BA, Vanderhaeghen R, Whitford R, Town CD, Hilson P.
  • ·Literature 2
    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.
    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.
    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 3
    • Title

    • Small cysteine-rich peptides resembling antimicrobial peptides have been under-predicted in plants.
    • Reference

    • Plant J. 2007 Jul;51(2):262-280.
    • Author

    • Silverstein KA, Moskal WA Jr, Wu HC, Underwood BA, Graham MA, Town CD, VandenBosch KA.