General Information

    • DRAMP ID

    • DRAMP00566

    • Peptide Name

    • Defensin-like protein 117 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • SDGTSGYGITEATKRCFTPAPCTRGLFYCQTFCSSLSAVLIGVCESGICCCILNQ

    • Sequence Length

    • 55

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00566 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00566.

Physicochemical Information

    • Formula

    • C246H389N65O79S8

    • Absent Amino Acids

    • HMW

    • Common Amino Acids

    • C

    • Mass

    • 5777.66

    • PI

    • 5.89

    • Basic Residues

    • 3

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 16

    • Net Charge

    • 0

    • Boman Index

    • -33.86

    • Hydrophobicity

    • 0.442

    • Aliphatic Index

    • 72.73

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 64.44

    • Polar Residues

    • 29

DRAMP00566

DRAMP00566 chydropathy plot

Comments Information

    • Function

    • Defense response to fungus.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.

    • Reference

    • Plant Biotechnol J. 2006 May;4(3):317-324.

    • Author

    • Underwood BA, Vanderhaeghen R, Whitford R, Town CD, Hilson P.
  • ·Literature 2

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 3

    • Title

    • Small cysteine-rich peptides resembling antimicrobial peptides have been under-predicted in plants.

    • Reference

    • Plant J. 2007 Jul;51(2):262-280.

    • Author

    • Silverstein KA, Moskal WA Jr, Wu HC, Underwood BA, Graham MA, Town CD, VandenBosch KA.