General Information

    • DRAMP ID

    • DRAMP00691

    • Peptide Name

    • Defensin-like protein 255 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • YEDSCSTDEECRRNCLCDVAYCDKSRDKCDYGFMNRVDVRFPKHPYISKNKDGSGR

    • Sequence Length

    • 56

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00691 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00691.

Physicochemical Information

    • Formula

    • C273H422N84O92S7

    • Absent Amino Acids

    • QW

    • Common Amino Acids

    • D

    • Mass

    • 6577.28

    • PI

    • 6.73

    • Basic Residues

    • 12

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +1

    • Boman Index

    • -209.59

    • Hydrophobicity

    • -1.211

    • Aliphatic Index

    • 31.25

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 115.18

    • Polar Residues

    • 22

DRAMP00691

DRAMP00691 chydropathy plot

Comments Information

    • Function

    • May have antifungal activity.

    • PTM

    • Contains two disulfide bonds (By similarity).

    • Caution

    • Could be the product of a pseudogene. Lacks 2 of the 4 disulfide bonds, which are conserved features of the family.

Literature Information

  • ·Literature 1

    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.

    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.

    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.
  • ·Literature 2

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.