• • DRAMP ID

  • DRAMP00704

• • Peptide Name

  • Defensin-like protein 269 (Plant defensin)

• • Source

  • Arabidopsis thaliana (Mouse-ear cress)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Not found

• • Sequence

  • RQMQRPQNVECVGGECQPKHPQQYFGSCFRDSDCRNSCFPYCRYQKCHHHECICSLCSSEVAPSPK

• • Sequence Length

  • 66

• • UniProt Entry

  • Q2V4F4

• • Protein Existence

  • Homology

• • Biological Activity

  • Antimicrobial, Antifungal

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00704.

DRAMP00704

• • Function

  • May have antifungal activity.

• • PTM

  • Contains four disulfide bonds (By similarity).

• ·Literature 1

• • Title

  • Genome organization of more than 300 defensin-like genes in Arabidopsis.

• • Pubmed ID

  • 15955924

• • Reference

  • Plant Physiol. 2005 Jun;138(2):600-610.

• • Author

  • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.