General Information

    • DRAMP ID

    • DRAMP00745

    • Peptide Name

    • Floral defensin-like protein 2 (PhD2; Plant defensin)

    • Source

    • Petunia hybrida (Petunia)

    • Family

    • Belongs to the DEFL family

    • Gene

    • D2

    • Sequence

    • GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC

    • Sequence Length

    • 49

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Fusarium oxysporum (86% inhibition at 10 µg/ml), Botrytis cinerea (41% inhibition at 10 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00745 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00745.

Physicochemical Information

    • Formula

    • C227H375N67O65S10

    • Absent Amino Acids

    • MY

    • Common Amino Acids

    • C

    • Mass

    • 5403.48

    • PI

    • 8.76

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +6

    • Boman Index

    • -73.36

    • Hydrophobicity

    • -0.288

    • Aliphatic Index

    • 51.84

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6125

    • Absorbance 280nm

    • 127.6

    • Polar Residues

    • 19

DRAMP00745

DRAMP00745 chydropathy plot

Comments Information

    • Function

    • Plant defense peptide with antifungal activity against F. oxysporum and Botrytis cinerea.

    • Tissue specificity

    • Petals.

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).

    • Biophysicochemical properties

    • pH dependence (Stable under extremes of pH); Temperature dependence (Stable under extremes of temperature).

    • PTM

    • Contains five disulfide bonds 3-49; 7-23; 14-36; 20-43; 24-45 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Isolation and properties of floral defensins from ornamental tobacco and petunia.

    • Reference

    • Plant Physiol. 2003 Mar;131(3):1283-1293.

    • Author

    • Lay FT, Brugliera F, Anderson MA.