General Information

    • DRAMP ID

    • DRAMP00752

    • Peptide Name

    • PsDef1 (P. sylvestris defensin 1, p1; Plant defensin)

    • Source

    • Pinus sylvestris (Scots pine)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Def1

    • Sequence

    • RMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP

    • Sequence Length

    • 50

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Botrytis cinerea (IC50=0.4 µg/ml), Fusarium oxysporum (IC50=2.9 µg/ml), Fusarium solani (IC50=0.9 µg/ml), Heterobasidion annosum (IC50=1.4 µg/ml), Candida albicans and Trichoderma reesei.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00752 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00752.

Physicochemical Information

    • Formula

    • C238H369N71O68S9

    • Absent Amino Acids

    • ILQW

    • Common Amino Acids

    • C

    • Mass

    • 5601.52

    • PI

    • 9.18

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +8

    • Boman Index

    • -102.15

    • Hydrophobicity

    • -0.662

    • Aliphatic Index

    • 19.4

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 101.43

    • Polar Residues

    • 26

DRAMP00752

DRAMP00752 chydropathy plot

Comments Information

    • Function

    • Plant defense peptide. Has antifungal activity.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Purification and molecular cloning of antimicrobial peptides from Scots pine seedlings.

    • Reference

    • Peptides. 2009 Dec;30(12):2136-2143.

    • Author

    • Kovaleva V, Kiyamova R, Cramer R, Krynytskyy H, Gout I, Filonenko V, Gout R.