• DRAMP ID

    • DRAMP00754
    • Peptide Name

    • Elicitor peptide 2 (AtPep2; Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the brassicaceae elicitor peptide family
    • Gene

    • PEP2
    • Sequence

    • DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED
    • Sequence Length

    • 36
    • Protein Existence

    • Homology
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00754 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00754.
    • Formula

    • C167H280N54O58
    • Absent Amino Acids

    • CFHLMW
    • Common Amino Acids

    • K
    • Mass

    • 3972.39
    • PI

    • 9.78
    • Basic Residues

    • 9
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +4
    • Boman Index

    • -135.47
    • Hydrophobicity

    • -1.772
    • Aliphatic Index

    • 35.28
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 42.57
    • Polar Residues

    • 11

DRAMP00754

DRAMP00754 chydropathy plot
    • Function

    • Elicitor of plant defense (By similarity).
  • ·Literature 1
    • Title

    • An endogenous peptide signal in Arabidopsis activates components of the innate immune response.
    • Reference

    • Proc Natl Acad Sci U S A. 2006 Jun 27;103(26):10098-103.
    • Author

    • Huffaker A, Pearce G, Ryan CA.
  • ·Literature 2
    • Title

    • Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones.
    • Reference

    • Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones.
    • Author

    • Sato S, Nakamura Y, Kaneko T, Katoh T, Asamizu E, Kotani H, Tabata S.