General Information

    • DRAMP ID

    • DRAMP00760

    • Peptide Name

    • NmDef02 (Plants)

    • Source

    • Nicotiana megalosiphon

    • Family

    • Belongs to the defensin family

    • Gene

    • Not found

    • Sequence

    • RECKAQGRHGTCFRDANCVQVCEKQAGWSHGDCRAQFKCKCIFEC

    • Sequence Length

    • 45

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00760 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00760.

Physicochemical Information

    • Formula

    • C212H331N71O63S8

    • Absent Amino Acids

    • LMPY

    • Common Amino Acids

    • C

    • Mass

    • 5138.88

    • PI

    • 8.51

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -118.33

    • Hydrophobicity

    • -0.678

    • Aliphatic Index

    • 30.44

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 136.36

    • Polar Residues

    • 15

DRAMP00760

DRAMP00760 chydropathy plot

Comments Information

    • Transgenic plants

    • Constitutive expression of NmDef02 gene in transgenic tobacco and potato plants enhanced resistance against various plant microbial pathogens, including the oomycete Phytophthora infestans, causal agent of the economically important pot

Literature Information

  • ·Literature 1

    • Title

    • NmDef02, a novel antimicrobial gene isolated from Nicotiana megalosiphon confers high-level pathogen resistance under greenhouse and field conditions.

    • Reference

    • Plant Biotechnol J. 2010 Aug;8(6):678-690.

    • Author

    • Portieles R, Ayra C, Gonzalez E, Gallo A, Rodriguez R, Chac³n O, L³pez Y, Rodriguez M, Castillo J, Pujol M, Enriquez G, Borroto C, Trujillo L, Thomma BP, Borr¡s-Hidalgo O.