General Information

    • DRAMP ID

    • DRAMP00768

    • Peptide Name

    • ChaC2 (Chassatide C2; Plant defensin)

    • Source

    • Chassalia chartacea

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCAESCVWIPPCTITALMGCSCKNNVCYNN

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC>80 µM);
      • Gram-positive bacteria: Staphylococcus aureus (MIC>80 µM), Staphylococcus epidermidis (MIC>80 µM).

    • Hemolytic Activity

      • [Ref.22467870] HD50>25 µM against human type A red blood cells.

    • Cytotoxicity

      • [Ref.22467870] Cytotoxicity: HeLa cells (IC50=2.4 µM).

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys 4 and Cys21, Cys8 and Cys23, Cys13 and Cys28.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00768 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00768.

Physicochemical Information

    • Formula

    • C143H226N38O44S7

    • Absent Amino Acids

    • DFHQR

    • Common Amino Acids

    • C

    • Mass

    • 3406.02

    • PI

    • 5.96

    • Basic Residues

    • 1

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • 0

    • Boman Index

    • -5.38

    • Hydrophobicity

    • 0.438

    • Aliphatic Index

    • 73.13

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 237.58

    • Polar Residues

    • 17

DRAMP00768

DRAMP00768 chydropathy plot

Comments Information

    • IC50=2.4 µM, HD50>25 µM.##Note

    • IC50 (concentration that gives a survival index of 50%) and HD50 (concentration that causes 50% lysis of red blood cells).

Literature Information

  • ·Literature 1

    • Title

    • Novel Cyclotides and Uncyclotides with Highly Shortened Precursors from Chassalia chartacea and Effects of Methionine Oxidation on Bioactivities.

    • Reference

    • J Biol Chem. 2012 May 18;287(21):17598-17607.

    • Author

    • Nguyen GK, Lim WH, Nguyen PQ, Tam JP.