• DRAMP ID

    • DRAMP00768
    • Peptide Name

    • ChaC2 (Chassatide C2; Plant defensin)
    • Source

    • Chassalia chartacea
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GIPCAESCVWIPPCTITALMGCSCKNNVCYNN
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer
    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC>80 µM);
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureusMIC>80 µM
        Staphylococcus epidermidisMIC>80 µM
    • Hemolytic Activity

      • [Ref.22467870] HD50>25 µM against human type A red blood cells.
    • Cytotoxicity

      • [Ref.22467870] Cytotoxicity: HeLa cells (IC50=2.4 µM).
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys 4 and Cys21, Cys8 and Cys23, Cys13 and Cys28.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00768 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00768.
    • Formula

    • C143H226N38O44S7
    • Absent Amino Acids

    • DFHQR
    • Common Amino Acids

    • C
    • Mass

    • 3406.02
    • PI

    • 5.96
    • Basic Residues

    • 1
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • 0
    • Boman Index

    • -5.38
    • Hydrophobicity

    • 0.438
    • Aliphatic Index

    • 73.13
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 237.58
    • Polar Residues

    • 17

DRAMP00768

DRAMP00768 chydropathy plot
    • IC50=2.4 µM, HD50>25 µM.##Note

    • IC50 (concentration that gives a survival index of 50%) and HD50 (concentration that causes 50% lysis of red blood cells).
  • ·Literature 1
    • Title

    • Novel Cyclotides and Uncyclotides with Highly Shortened Precursors from Chassalia chartacea and Effects of Methionine Oxidation on Bioactivities.
    • Reference

    • J Biol Chem. 2012 May 18;287(21):17598-17607.
    • Author

    • Nguyen GK, Lim WH, Nguyen PQ, Tam JP.