General Information

    • DRAMP ID

    • DRAMP00773

    • Peptide Name

    • Psyle E (Cyclotides; Plants)

    • Source

    • Psychotria leptothyrsa

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GVIPCGESCVFIPCISSVLGCSCKNKVCYRD

    • Sequence Length

    • 31

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Anti-cancer

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.20575512] Cytotoxicity: the human lymphoma cell line U-937 GTB (IC50=0.76 µM).

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys I and CysIV, CysII and CysV, CysIII and CysVI .

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00773 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00773.

Physicochemical Information

    • Formula

    • C139H227N37O42S6

    • Absent Amino Acids

    • AHMQTW

    • Common Amino Acids

    • C

    • Mass

    • 3280.91

    • PI

    • 7.77

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +1

    • Boman Index

    • -12.61

    • Hydrophobicity

    • 0.652

    • Aliphatic Index

    • 87.74

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 62.17

    • Polar Residues

    • 15

DRAMP00773

DRAMP00773 chydropathy plot

Comments Information

    • Function

    • Cyclotide cytotoxicity on the human lymphoma cell line U-937 GTB (IC50=0.76 µM).

Literature Information

  • ·Literature 1

    • Title

    • Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa.

    • Reference

    • J Nat Prod. 2010 Jul 23;73(7):1207-1213.

    • Author

    • Gerlach SL, Burman R, Bohlin L, Mondal D, Göransson U.