• DRAMP ID

    • DRAMP00774
    • Peptide Name

    • Hedyotide B1 (hB1; Plants)
    • Source

    • Hedyotis biflora (aerial tissues)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Unknow
    • Sequence

    • GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
    • Sequence Length

    • 30
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknow
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=3.4 µM);
      • Gram-positive bacteria: Streptococcus salivarius(MIC=5.9 µM), Staphylococcus epidermidis (MIC>80 µM), S. aureus (MIC>80 µM).
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00774 helical wheel diagram
    • Formula

    • C150H219N41O40S6
    • Absent Amino Acids

    • DHIM
    • Common Amino Acids

    • C
    • Mass

    • 3946.45
    • PI

    • 8.38
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 7
    • Boman Index

    • -35.27
    • Hydrophobicity

    • -10
    • Aliphatic Index

    • 26
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 305.34
    • Polar Residues

    • 16
browser doesn't support html5

Amino Acid Distribution

DRAMP00774 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • J Biol Chem. 2011 Dec 30;286(52):44833-44844.
    • Author

    • Nguyen GK, Zhang S, Wang W, Wong CT, Nguyen NT, Tam JP.
    • Title

    • Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry.