General Information
-
DRAMP ID
- DRAMP00774
-
Peptide Name
- Hedyotide B1 (hB1; Plants)
-
Source
- Hedyotis biflora (aerial tissues)
-
Family
- Belongs to the cyclotide family
-
Gene
- Not found
-
Sequence
- GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
-
Sequence Length
- 30
-
UniProt Entry
- No entry found
-
Protein Existence
- Not found
Activity Information
-
Biological Activity
- Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
-
Target Organism
-
- Gram-negative bacterium: Escherichia coli (MIC=3.4 µM);
- Gram-positive bacteria: Streptococcus salivarius(MIC=5.9 µM), Staphylococcus epidermidis (MIC>80 µM), S. aureus (MIC>80 µM).
-
Hemolytic Activity
-
- No hemolysis information or data found in the reference(s) presented in this entry
-
Cytotoxicity
- No cytotoxicity information found in the reference(s) presented
-
Binding Target
- Not found
Structure Information
-
Linear/Cyclic
- Cyclic
-
N-terminal Modification
- Free
-
C-terminal Modification
- Free
-
Nonterminal Modifications and Unusual Amino Acids
- There are three disulfide bonds in the peptide structure
-
Stereochemistry
- L
-
Structure
- Not found
-
Structure Description
- Not found
-
Helical Wheel Diagram
-
PDB ID
- None
-
Predicted Structure
- There is no predicted structure for DRAMP00774.
Physicochemical Information
-
Formula
- C150H219N41O40S6
Absent Amino Acids
- DHIM
Common Amino Acids
- C
Mass
- 3429
PI
- 8.66
Basic Residues
- 4
Acidic Residues
- 1
Hydrophobic Residues
- 7
Net Charge
- +3
-
Boman Index
- -35.27
Hydrophobicity
- -0.1
Aliphatic Index
- 26
Half Life
-
- Mammalian:30 hour
- Yeast:>20 hour
- E.coli:>10 hour
Extinction Coefficient Cystines
- 8855
Absorbance 280nm
- 305.34
Polar Residues
- 16
DRAMP00774
Comments Information
Comment
- No comments found on DRAMP database
Literature Information
- ·Literature 1
-
Title
- Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry.
-
Pubmed ID
- 21979955
-
Reference
- J Biol Chem. 2011 Dec 30;286(52):44833-44844.
-
Author
- Nguyen GK, Zhang S, Wang W, Wong CT, Nguyen NT, Tam JP.
