General Information

    • DRAMP ID

    • DRAMP00774

    • Peptide Name

    • Hedyotide B1 (hB1; Plants)

    • Source

    • Hedyotis biflora (aerial tissues)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GTRCGETCFVLPCWSAKFGCYCQKGFCYRN

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=3.4 µM);
      • Gram-positive bacteria: Streptococcus salivarius(MIC=5.9 µM), Staphylococcus epidermidis (MIC>80 µM), S. aureus (MIC>80 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are three disulfide bonds in the peptide structure

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00774 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C150H219N41O40S6

    • Absent Amino Acids

    • DHIM

    • Common Amino Acids

    • C

    • Mass

    • 3429

    • PI

    • 8.66

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +3

    • Boman Index

    • -35.27

    • Hydrophobicity

    • -0.1

    • Aliphatic Index

    • 26

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 305.34

    • Polar Residues

    • 16

DRAMP00774

DRAMP00774 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry.

    • Reference

    • J Biol Chem. 2011 Dec 30;286(52):44833-44844.

    • Author

    • Nguyen GK, Zhang S, Wang W, Wong CT, Nguyen NT, Tam JP.