General Information

    • DRAMP ID

    • DRAMP00775

    • Peptide Name

    • Mram 8 (Plants)

    • Source

    • Viola philippica

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCGESCVFIPCLTSAIDCSCKSKVCYRN

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Anti-cancer

    • Target Organism

      • Cancer cell lines: BGC-823 (IC50=1.75±0.05 µM), MM96L (IC50=4.91±0.04 µM), HeLa (IC50=15.5±0.06 µM).
      • Non-cancer cell line: HFF-1 (IC50=3.19±0.01 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00775 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00775.

Physicochemical Information

    • Formula

    • C134H218N36O42S6

    • Absent Amino Acids

    • HMQW

    • Common Amino Acids

    • C

    • Mass

    • 3197.78

    • PI

    • 7.77

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +1

    • Boman Index

    • -22.39

    • Hydrophobicity

    • 0.443

    • Aliphatic Index

    • 74.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 64.31

    • Polar Residues

    • 15

DRAMP00775

DRAMP00775 chydropathy plot

Comments Information

    • Function

    • The novel cyclotides show cytotoxic activity against several cancer cell lines.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of cytotoxic cyclotides from Viola philippica.

    • Reference

    • Peptides. 2011 Aug;32(8):1719-1723.

    • Author

    • He W, Chan LY, Zeng G, Daly NL, Craik DJ, Tan N.