• DRAMP ID

    • DRAMP00795
    • Peptide Name

    • Cliotide T1 (cT1; Plant defensin)
    • Source

    • Clitoria ternatea (Butterfly pea)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Unknown
    • Sequence

    • GIPCGESCVFIPCITAAIGCSCKSKVCYRN
    • Sequence Length

    • 30
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • [Ref.21596752]Gram-positive bacteria: Staphylococcus aureus ATCC12600, Enterococcus faecalis ATCC 47077 (less active);
      • Gram-negative bacteria: Escherichia coli ATCC 700926 (MIC=1.1 µM), Pseudomonas aeruginosa ATCC 39018 (MIC=2.7 µM), Klebsiella pneumonia ATCC 13883 (MIC=4.7 µM).
    • Hemolytic activity

      • [Ref:21596752]HD50=7.1 µM against human type A erythrocytes
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00795 helical wheel diagram
    • Formula

    • C132H216N36O39S6
    • Absent Amino Acids

    • DHLMQW
    • Common Amino Acids

    • C
    • Mass

    • 3641.21
    • PI

    • 8.11
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -7.52
    • Hydrophobicity

    • 65.67
    • Aliphatic Index

    • 78
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 64.31
    • Polar Residues

    • 15

DRAMP00795

DRAMP00795 chydropathy plot
    • Function

    • Cliotide T1 shows stronger antimicrobial activity against the Gram-negative bacteria than the Gram-positive bacteria. It also has hemolytic activity against human type A erythrocytes (HD50=7.1 µM) and cytotoxicity against HeLa Cells (IC50=0.6 µM).
    • [Note

    • HD50 refers to the peptide concentration that causes 50% lysis of red blood cells; IC50 refers to the peptide concentration that causes 50% death of HeLa cells].
  • Literature 1
    • Reference

    • J Biol Chem. 2011 Jul 8;286(27):24275-24287.
    • Author

    • Nguyen GK, Zhang S, Nguyen NT, Nguyen PQ, Chiu MS, Hardjojo A, Tam JP.
    • Title

    • Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family.