General Information

    • DRAMP ID

    • DRAMP00796

    • Peptide Name

    • Cliotide T2 (cT2; Plant defensin)

    • Source

    • Clitoria ternatea (Butterfly pea)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GEFLKCGESCVQGECYTPGCSCDWPICKKN

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer

    • Target Organism

      • [Ref.21596752]Gram-positive bacteria: Staphylococcus aureus ATCC12600, Enterococcus faecalis ATCC 47077 (less active);
      • Gram-negative bacteria: Escherichia coli ATCC 700926 (MIC>100 µM), Pseudomonas aeruginosa ATCC 39018 (MIC>100 µM), Klebsiella pneumonia ATCC 13883 (MIC>100 µM).

    • Hemolytic Activity

      • [Ref:21596752] HD50>100 µM against human type A erythrocytes

    • Cytotoxicity

      • [Ref.21596752] Cytotoxicity: HeLa Cells (IC50=8.0 µM).

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys I and CysIV, CysII and CysV, CysIII and CysVI.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00796 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00796.

Physicochemical Information

    • Formula

    • C138H210N36O45S6

    • Absent Amino Acids

    • AHMR

    • Common Amino Acids

    • C

    • Mass

    • 3285.76

    • PI

    • 4.87

    • Basic Residues

    • 3

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 5

    • Net Charge

    • -1

    • Boman Index

    • -36.86

    • Hydrophobicity

    • -0.39

    • Aliphatic Index

    • 35.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 15

DRAMP00796

DRAMP00796 chydropathy plot

Comments Information

    • Function

    • Cliotide T2 shows stronger antimicrobial activity against the Gram-negative bacteria than the Gram-positive bacteria. Cliotide T2 was relatively nonhemolytic (HD50>100 µM) .

Literature Information

  • ·Literature 1

    • Title

    • Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family.

    • Reference

    • J Biol Chem. 2011 Jul 8;286(27):24275-24287.

    • Author

    • Nguyen GK, Zhang S, Nguyen NT, Nguyen PQ, Chiu MS, Hardjojo A, Tam JP.