General Information

    • DRAMP ID

    • DRAMP00801

    • Peptide Name

    • Cycloviolin-C (Plant defensin)

    • Source

    • Leonia cymosa (Sacha uba)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCGESCVFIPCLTTVAGCSCKNKVCYRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • [Ref.18008336]Virus:HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=130 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.18008336]CEM-SS cells:IC50=560 nM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization (N termini to C termini)

    • C-terminal Modification

    • Cyclization (N termini to C termini)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22,Cys13 and Cys27.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00801 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00801.

Physicochemical Information

    • Formula

    • C133H217N37O40S6

    • Absent Amino Acids

    • DHMQW

    • Common Amino Acids

    • C

    • Mass

    • 3166.77

    • PI

    • 8.33

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -16.02

    • Hydrophobicity

    • 0.45

    • Aliphatic Index

    • 71.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 64.31

    • Polar Residues

    • 16

DRAMP00801

DRAMP00801 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Has anti-HIV activity.

    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-20;8-22;13-27.

Literature Information

  • ·Literature 1

    • Title

    • Cycloviolins A-D, anti-HIV macrocyclic peptides from Leonia cymosa.

    • Reference

    • J Org Chem. 2000 Jan 14;65(1):124-128.

    • Author

    • Hallock YF, Sowder RC 2nd, Pannell LK, Hughes CB, Johnson DG, Gulakowski R, Cardellina JH 2nd, Boyd MR.
  • ·Literature 2

    • Title

    • Cyclotides as natural anti-HIV agents.

    • Reference

    • Biopolymers. 2008;90(1):51-60.

    • Author

    • Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.