General Information

    • DRAMP ID

    • DRAMP00803

    • Peptide Name

    • Palicourein (Cyclotides; Plants)

    • Source

    • Palicourea condensata (Cappel)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • [Ref.18008336]Virus:HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=100 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.11430013] Cytotoxicity: human T-lymphoblastoid cell line (CEM-SS)(EC50=0.10 Μm, IC50=1.5 μM) .
      • [Ref.18008336]CEM-SS cells:IC50=1500 nM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization (N termini to C termini)

    • C-terminal Modification

    • Cyclization (N termini to C termini)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys1 and Cys19; Cys5 and Cys21; Cys11 and Cys28;hydrogen bonds between the oxygen atoms of the Glu3 carboxyl group and the backbone amides of residues Thr12, Thr13, and Ser14, and the side chain of Ser14.

    • Stereochemistry

    • L

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Palicourein has an atypical size and composition within one of the surface-exposed loops.

    • Helical Wheel Diagram

    • DRAMP00803 helical wheel diagram

    • PDB ID

    • 1R1F resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00803.

Physicochemical Information

    • Formula

    • C159H256N48O56S6

    • Absent Amino Acids

    • HMQW

    • Common Amino Acids

    • C

    • Mass

    • 3928.43

    • PI

    • 4.78

    • Basic Residues

    • 4

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 8

    • Net Charge

    • -1

    • Boman Index

    • -74.98

    • Hydrophobicity

    • -0.189

    • Aliphatic Index

    • 52.7

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 51.81

    • Polar Residues

    • 18

DRAMP00803

DRAMP00803 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus.

    • In vitro activity

    • Palicourein inhibits the cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 µM and an IC50 value of 1.5 µM.

    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 6-24; 10-26; 16-34.

Literature Information

  • ·Literature 1

    • Title

    • A novel anti-HIV macrocyclic peptide from Palicourea condensata.

    • Reference

    • J Nat Prod. 2001 Feb;64(2):249-250.

    • Author

    • Bokesch HR, Pannell LK, Cochran PK, Sowder RC 2nd, McKee TC, Boyd MR.
  • ·Literature 2

    • Title

    • Solution structure of the cyclotide palicourein: implications for the development of a pharmaceutical framework.

    • Reference

    • Structure. 2004 Jan;12(1):85-94.

    • Author

    • Barry DG, Daly NL, Bokesch HR, Gustafson KR, Craik DJ.
  • ·Literature 3

    • Title

    • Cyclotides as natural anti-HIV agents.

    • Reference

    • Biopolymers. 2008;90(1):51-60.

    • Author

    • Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.