General Information

    • DRAMP ID

    • DRAMP00805

    • Peptide Name

    • Cycloviolacin-O2 (Plant defensin)

    • Source

    • Viola biflora (Yellow wood violet) & Viola odorata (Sweet violet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCGESCVWIPCISSAIGCSCKSKVCYRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

      • [Ref.16872274]Human tumor cell lines: RPMI-8226/s (IC50=0.12 µM), RPMI-8226/Dox40 (IC50=0.12 µM), RPMI-8226/LR-5 (IC50=0.12 µM), U-937GTB (IC50=0.26 µM), U-937Vcr (IC50=0.20 µM), ACHN (IC50=0.22 µM), CCRF-CEM (IC50=0.11 µM), CCRF-CEM/VM-1 (IC50=0.14 µM), NCI-H69 (IC50=0.12 µM), NCI-H69AR (IC50=0.26 µM).

    • Hemolytic Activity

      • [Ref:16872274] It has 35% hemolytic activity at 1.0 μM and 60% hemolytic activity at 1.5 μM against human type A red blood cells

    • Cytotoxicity

      • [Ref.20580652] Cytotoxicity: U251(IC50=17.05μg/mL), MDA-MB-231(IC50=4.81μg/mL), A549(IC50=5.99μg/mL), DU145(IC50=5.08μg/mL), BEL-7402(IC5=6.07μg/mL).

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.

    • Stereochemistry

    • L

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00805 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00805.

Physicochemical Information

    • Formula

    • C133H215N37O40S6

    • Absent Amino Acids

    • DFHLMQT

    • Common Amino Acids

    • C

    • Mass

    • 3164.75

    • PI

    • 8.33

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -14.21

    • Hydrophobicity

    • 0.443

    • Aliphatic Index

    • 74.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 16

DRAMP00805

DRAMP00805 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Has strong cytotoxic activity against a variety of drug-resistant and drug-sensitive human tumor cell lines, and against primary chronic lymphocytic leukemia and ovarian carcinoma cells. Has weaker cytotoxic activity against normal lymphocytes. Has hemolytic activity.

    • PTM

    • This is a cyclic peptide which contains three disulfide bonds 4-20; 8-22; 13-27.

Literature Information

  • ·Literature 1

    • Title

    • A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability..

    • Reference

    • Biochem J. 2006 Nov 15;400(1):1-12.

    • Author

    • Ireland DC, Colgrave ML, Craik DJ.
  • ·Literature 2

    • Title

    • Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.

    • Reference

    • J Mol Biol. 1999 Dec 17;294(5):1327-1336.

    • Author

    • Craik DJ, Daly NL, Bond T, Waine C.
  • ·Literature 3

    • Title

    • A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability

    • Reference

    • Biochem J . 2006 Nov 15;400(1):1-12.

    • Author

    • David C Ireland 1, Michelle L Colgrave, David J Craik