• DRAMP ID

    • DRAMP00806
    • Peptide Name

    • Cycloviolacin-O3 (Plant defensin)
    • Source

    • Viola odorata (Sweet violet)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • Biological Activity

    • Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00806 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00806.
    • Formula

    • C134H217N37O40S6
    • Absent Amino Acids

    • DFHMQ
    • Common Amino Acids

    • C
    • Mass

    • 3178.78
    • PI

    • 8.33
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +2
    • Boman Index

    • -13.38
    • Hydrophobicity

    • 0.423
    • Aliphatic Index

    • 74.67
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 253.97
    • Polar Residues

    • 16

DRAMP00806

DRAMP00806 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism.
    • PTM

    • This is a cyclic peptide which contains three disulfide bonds 4-20; 8-22; 13-27.
  • ·Literature 1
    • Title

    • A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability..
    • Reference

    • Biochem J. 2006 Nov 15;400(1):1-12.
    • Author

    • Ireland DC, Colgrave ML, Craik DJ.
  • ·Literature 2
    • Title

    • Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
    • Reference

    • J Mol Biol. 1999 Dec 17;294(5):1327-1336.
    • Author

    • Craik DJ, Daly NL, Bond T, Waine C.