General Information

    • DRAMP ID

    • DRAMP00816

    • Peptide Name

    • Cycloviolacin-O13 (Cyclotide c3; Plant defensin)

    • Source

    • Viola odorata (Sweet violet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Voc3

    • Sequence

    • GIPCGESCVWIPCISAAIGCSCKSKVCYRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antiviral,Insecticidal

    • Target Organism

      • [Ref.18008336]Virus:HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=320 nM).

    • Hemolytic Activity

      • [Ref:16872274] It has 50% hemolytic activity at 1.0 μM and 75% hemolytic activity at 1.5 μM against human type A red blood cells

    • Cytotoxicity

      • [Ref.18008336]CEM-SS cells:IC50=6400 nM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization (N termini to C termini)

    • C-terminal Modification

    • Cyclization (N termini to C termini)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00816 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00816.

Physicochemical Information

    • Formula

    • C133H215N37O39S6

    • Absent Amino Acids

    • DFHLMQT

    • Common Amino Acids

    • C

    • Mass

    • 3148.75

    • PI

    • 8.33

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +2

    • Boman Index

    • -9

    • Hydrophobicity

    • 0.53

    • Aliphatic Index

    • 78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 15

DRAMP00816

DRAMP00816 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Has hemolytic activity.

    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-20; 8-22; 13-27.

Literature Information

  • ·Literature 1

    • Title

    • A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.

    • Reference

    • Biochem J. 2006 Nov 15;400(1):1-12.

    • Author

    • Ireland DC, Colgrave ML, Craik DJ.
  • ·Literature 2

    • Title

    • Cyclotides as natural anti-HIV agents.

    • Reference

    • Biopolymers. 2008;90(1):51-60.

    • Author

    • Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.