General Information

    • DRAMP ID

    • DRAMP00837

    • Peptide Name

    • Cycloviolacin-Y5 (Plants)

    • Source

    • Viola yedoensis (Chinese herb)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCAESCVWIPCTVTALVGCSCSDKVCYN

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • [Ref.18618891]Effects: H. contortus( IC50=2.28μM, IC99=22.24μM) and T. colubriformis(IC50=2.40μM, IC99=10.97μM).
      • [Ref.18008336]Virus:HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=40 nM).

    • Hemolytic Activity

      • [Ref:18081258] HD50=8.7 μM against human type A red blood cells.

    • Cytotoxicity

      • [Ref.18008336]CEM-SS cells:IC50=1760 nM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization (N termini to C termini)

    • C-terminal Modification

    • Cyclization (N termini to C termini)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys21; Cys8 and Cys23; Cys13 and Cys28.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00837 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00837.

Physicochemical Information

    • Formula

    • C132H209N33O42S6

    • Absent Amino Acids

    • FHMQR

    • Common Amino Acids

    • C

    • Mass

    • 3122.67

    • PI

    • 4.37

    • Basic Residues

    • 1

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • -1

    • Boman Index

    • 3.23

    • Hydrophobicity

    • 0.793

    • Aliphatic Index

    • 84.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 15

DRAMP00837

DRAMP00837 chydropathy plot

Comments Information

    • Function

    • Has anti-HIV activity. Cycloviolacin Y5 is the most hydrophobic of the cyclotides from V. yedoensis, and is more hemolytic than cycloviolacin Y1.

    • PTM

    • Contains three disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Anti-HIV cyclotides from the Chinese medicinal herb Viola yedoensis.

    • Reference

    • J Nat Prod. 2008 Jan;71(1):47-52.

    • Author

    • Wang CK, Colgrave ML, Gustafson KR, Ireland DC, Goransson U, Craik DJ.
  • ·Literature 2

    • Title

    • Cyclotides as natural anti-HIV agents

    • Reference

    • Biopolymers. 2008;90(1):51-60.

    • Author

    • David C Ireland, Conan K L Wang, Jennifer A Wilson, Kirk R Gustafson, David J Craik
  • ·Literature 3

    • Title

    • The anthelmintic activity of the cyclotides: natural variants with enhanced activity

    • Reference

    • Chembiochem. 2008 Aug 11;9(12):1939-45. doi: 10.1002/cbic.200800174.

    • Author

    • Michelle L Colgrave, Andrew C Kotze, David C Ireland, Conan K Wang, David J Craik