General Information

    • DRAMP ID

    • DRAMP00838

    • Peptide Name

    • Cyclotide phyb-A (Plant defensin)

    • Source

    • Petunia hybrida (Petunia)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIGCGESCVWIPCVSAAIGCSCSNKICYRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00838 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00838.

Physicochemical Information

    • Formula

    • C128H205N37O40S6

    • Absent Amino Acids

    • DFHLMQT

    • Common Amino Acids

    • C

    • Mass

    • 3094.62

    • PI

    • 7.77

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +1

    • Boman Index

    • -9.15

    • Hydrophobicity

    • 0.583

    • Aliphatic Index

    • 78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 17

DRAMP00838

DRAMP00838 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism (By similarity).

    • Tissue specificity

    • Expressed in midvein, lamina and periphery of leaves (at protein level).

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.

    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-2; 8-22; 13-27.

Literature Information

  • ·Literature 1

    • Title

    • Cyclotides associate with leaf vasculature and are the products of a novel precursor in Petunia (Solanaceae).

    • Reference

    • J. Biol. Chem. 2012;287:27033-27046.

    • Author

    • Poth A.G, Mylne J.S, Grassl J, Lyons R.E, Millar A.H, Colgrave M.L, Craik D.J.