General Information

    • DRAMP ID

    • DRAMP00844

    • Peptide Name

    • Cyclotide cter-F (Plant defensin)

    • Source

    • Clitoria ternatea (Butterfly pea)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCGESCVFIPCISSVVGCSCKSKVCYLD

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00844 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00844.

Physicochemical Information

    • Formula

    • C132H214N32O41S6

    • Absent Amino Acids

    • AHMNQRTW

    • Common Amino Acids

    • C

    • Mass

    • 3097.7

    • PI

    • 6.03

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • 0

    • Boman Index

    • 5.55

    • Hydrophobicity

    • 0.913

    • Aliphatic Index

    • 90.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 64.31

    • Polar Residues

    • 15

DRAMP00844

DRAMP00844 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-20; 8-22; 13-27.

Literature Information

  • ·Literature 1

    • Title

    • Discovery of cyclotides in the fabaceae plant family provides new insights into the cyclization, evolution, and distribution of circular proteins.

    • Reference

    • ACS Chem Biol. 2011 Apr 15;6(4):345-355.

    • Author

    • Poth AG, Colgrave ML, Philip R, Kerenga B, Daly NL, Anderson MA, Craik DJ.