General Information

    • DRAMP ID

    • DRAMP00864

    • Peptide Name

    • Kalata-B9 (Plant defensin)

    • Source

    • Oldenlandia affinis

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys6 and Cys20; Cys10 and Cys22; Cys15 and Cys28.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00864 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00864.

Physicochemical Information

    • Formula

    • C135H211N37O47S6

    • Absent Amino Acids

    • AHIMQW

    • Common Amino Acids

    • CT

    • Mass

    • 3296.74

    • PI

    • 6.03

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 5

    • Net Charge

    • 0

    • Boman Index

    • -36.92

    • Hydrophobicity

    • 0.032

    • Aliphatic Index

    • 40.65

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 111.83

    • Polar Residues

    • 21

DRAMP00864

DRAMP00864 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • Kalata-B9 is a cyclic peptide which contains three disulfide bonds 6-20; 10-22; 15-28.

Literature Information

  • ·Literature 1

    • Title

    • The cyclotide fingerprint in oldenlandia affinis: elucidation of chemically modified, linear and novel macrocyclic peptides.

    • Reference

    • Chembiochem. 2007 Jun 18;8(9):1001-1011.

    • Author

    • Plan MR, Göransson U, Clark RJ, Daly NL, Colgrave ML, Craik DJ.