General Information

    • DRAMP ID

    • DRAMP00872

    • Peptide Name

    • Kalata-B16 (Plant defensin)

    • Source

    • Oldenlandia affinis

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCAESCVYIPCTITALLGCKCQDKVCYD

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys21,Cys8 and Cys23,Cys13 and Cys28.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00872 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00872.

Physicochemical Information

    • Formula

    • C137H221N33O43S6

    • Absent Amino Acids

    • FHMNRW

    • Common Amino Acids

    • C

    • Mass

    • 3210.82

    • PI

    • 4.56

    • Basic Residues

    • 2

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • -1

    • Boman Index

    • -3.85

    • Hydrophobicity

    • 0.583

    • Aliphatic Index

    • 91

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 115.69

    • Polar Residues

    • 13

DRAMP00872

DRAMP00872 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • Kalata-B16 are cyclic peptides which may contain three disulfide bonds 4-21; 8-23; 13-28.

Literature Information

  • ·Literature 1

    • Title

    • The cyclotide fingerprint in oldenlandia affinis: elucidation of chemically modified, linear and novel macrocyclic peptides.

    • Reference

    • Chembiochem. 2007 Jun 18;8(9):1001-1011.

    • Author

    • Plan MR, Göransson U, Clark RJ, Daly NL, Colgrave ML, Craik DJ.