• DRAMP ID

    • DRAMP00873
    • Peptide Name

    • Kalata-B17 (Plant defensin)
    • Source

    • Oldenlandia affinis
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GIPCAESCVYIPCTITALLGCKCKDQVCYN
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys21,Cys8 and Cys23,Cys13 and Cys28.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00873 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00873.
    • Formula

    • C137H222N34O42S6
    • Absent Amino Acids

    • FHMRW
    • Common Amino Acids

    • C
    • Mass

    • 3209.83
    • PI

    • 6.03
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 9
    • Net Charge

    • 0
    • Boman Index

    • -1.77
    • Hydrophobicity

    • 0.583
    • Aliphatic Index

    • 91
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 115.69
    • Polar Residues

    • 14

DRAMP00873

DRAMP00873 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism.
    • PTM

    • Kalata-B16 are cyclic peptides which may contain three disulfide bonds 4-21; 8-23; 13-28.
  • ·Literature 1
    • Title

    • The cyclotide fingerprint in oldenlandia affinis: elucidation of chemically modified, linear and novel macrocyclic peptides.
    • Reference

    • Chembiochem. 2007 Jun 18;8(9):1001-1011.
    • Author

    • Plan MR, Göransson U, Clark RJ, Daly NL, Colgrave ML, Craik DJ.