General Information

    • DRAMP ID

    • DRAMP00876

    • Peptide Name

    • Leaf cyclotide 2 (Vhl-2; Plant defensin)

    • Source

    • Viola hederacea (Australian violet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GLPVCGETCFTGTCYTNGCTCDPWPVCTRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • [Ref.15824119]Virus: HIV(EC50= 0.87 μM)

    • Hemolytic Activity

      • [Ref:15824119]Has hemolytic activity

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • cell membrabce

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Beta strand (5 strands; 6 residues)

    • Structure Description

    • Analysis of surface hydrophobicity and haemolytic activity for a range of cyclotides indicates a correlation between them, with increasing hydrophobicity resulting in increased haemolytic activity.

    • Helical Wheel Diagram

    • DRAMP00876 helical wheel diagram

    • PDB ID

    • 2KUK resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00876.

Physicochemical Information

    • Formula

    • C133H200N36O44S6

    • Absent Amino Acids

    • AHIKMQS

    • Common Amino Acids

    • CT

    • Mass

    • 3199.63

    • PI

    • 4.37

    • Basic Residues

    • 1

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 5

    • Net Charge

    • -1

    • Boman Index

    • -29.54

    • Hydrophobicity

    • -0.043

    • Aliphatic Index

    • 32.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 19

DRAMP00876

DRAMP00876 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Has hemolytic activity.

    • Tissue specificity

    • Expressed in leaves.

    • PTM

    • This is a cyclic peptide which contains three disulfide bonds 5-19; 9-21; 14-27.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of novel cyclotides from Viola hederaceae: solution structure and anti-HIV activity of vhl-1, a leaf-specific expressed cyclotide.

    • Reference

    • J Biol Chem. 2005 Jun 10;280(23):22395-22405.

    • Author

    • Chen B, Colgrave ML, Daly NL, Rosengren KJ, Gustafson KR, Craik DJ.
  • ·Literature 2

    • Title

    • Structure and activity of the leaf-specific cyclotide vhl-2.

    • Reference

    • Aust. J. Chem. 2010;63:771-778.

    • Author

    • Daly NL, Chen B, Nguyencong P, Craik DJ.