• DRAMP ID

    • DRAMP00878
    • Peptide Name

    • Circulin-B (CIRB; Plant defensin)
    • Source

    • Chassalia parviflora
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Unknown
    • Sequence

    • GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
    • Sequence Length

    • 31
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-positive bacterium: (L-salt): Staphylococcus aureus (MIC=13.5 µM).
      • Gram-negative bacteria: (L-salt, H-salt) (MIC µM): Escherichia coli (0.41, >500), Pseudomonas aeruginosa (25.5, 48), Proteus vulgaris (6.8, >500), Klebsiella oxytoca (8.2, 15.6).
      • Fungi (H-salt): Candida kefyr (MIC=29 µM).
      • NOTE: L-salt = Medium with 10 mM phosphate buffer; H-salt = L-salt supplemented with 100 mM NaCl.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Beta strand (5 strands; 10 residues)
    • Structure Description

    • Cyclotides are mini-proteins derived from plants that have the characteristic features of a head-to-tail cyclised peptide backbone and a knotted arrangement of their three disulfide bonds.
    • PDB ID

    • 2ERI resolved by NMR.
    • DRAMP00878 helical wheel diagram
    • 2ERI-> 
    • Formula

    • C141H232N38O41S6
    • Absent Amino Acids

    • ADHMQW
    • Common Amino Acids

    • C
    • Mass

    • 3843.28
    • PI

    • 8.11
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -8.82
    • Hydrophobicity

    • 64.19
    • Aliphatic Index

    • 90.97
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 62.17
    • Polar Residues

    • 16

DRAMP00878

DRAMP00878 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism. Has antibiotic activity. Inhibits the cytopathic effects and replication of the human immunodeficiency virus. Active against both Gram-positive and Gram-negative bacteria.
    • PTM

    • This is a cyclic peptide which contains three disulfide bonds 5-21; 9-23; 14-28.
  • Literature 1
    • Reference

    • Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8913-8918.
    • Author

    • Tam JP, Lu YA, Yang JL, Chiu KW.
    • Title

    • An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.
  • Literature 2
    • Pubmed ID

    • Reference

    • Int. J. Pept. Protein Res. 2005;11:99-106.
    • Author

    • Koltay A, Daly N.L, Gustafson K.R, Craik D.J.
    • Title

    • Structure of circulin B and implications for antimicrobial activity of the cyclotides.