• DRAMP ID

    • DRAMP00886
    • Peptide Name

    • Cyclotide hyfl-C (Plant defensin)
    • Source

    • Hybanthus floribundus (Greenviolet)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
    • Sequence Length

    • 32
    • Protein Existence

    • Protein level
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Cyclotides are plant-derived miniproteins that have the unusual features of a head-to-tail cyclized peptide backbone and a knotted arrangement of disulfide bonds.
    • Helical Wheel Diagram

    • DRAMP00886 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00886.
    • Formula

    • C146H231N39O47S7
    • Absent Amino Acids

    • DHVW
    • Common Amino Acids

    • C
    • Mass

    • 3509.09
    • PI

    • 6.19
    • Basic Residues

    • 3
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 7
    • Net Charge

    • 0
    • Boman Index

    • -35.26
    • Hydrophobicity

    • 0.022
    • Aliphatic Index

    • 42.81
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 60.16
    • Polar Residues

    • 16

DRAMP00886

DRAMP00886 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism.
    • PTM

    • This is is a cyclic peptide which may contain three disulfide bonds 4-21; 8-23; 13-28.
  • ·Literature 1
    • Title

    • A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae).
    • Reference

    • Plant Cell. 2005 Nov;17(11):3176-3189.
    • Author

    • Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Göransson U, Craik DJ.