General Information

    • DRAMP ID

    • DRAMP00889

    • Peptide Name

    • Cyclotide hyfl-F (Plant defensin)

    • Source

    • Hybanthus floribundus (Greenviolet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • SISCGETCTTFNCWIPNCKCNHHDKVCYWN

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Cyclotides are plant-derived miniproteins that have the unusual features of a head-to-tail cyclized peptide backbone and a knotted arrangement of disulfide bonds.

    • Helical Wheel Diagram

    • DRAMP00889 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00889.

Physicochemical Information

    • Formula

    • C149H216N42O45S6

    • Absent Amino Acids

    • ALMQR

    • Common Amino Acids

    • C

    • Mass

    • 3507.97

    • PI

    • 6.64

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +2

    • Boman Index

    • -47.02

    • Hydrophobicity

    • -0.433

    • Aliphatic Index

    • 35.67

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 443.62

    • Polar Residues

    • 17

DRAMP00889

DRAMP00889 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

Literature Information

  • ·Literature 1

    • Title

    • A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae).

    • Reference

    • Plant Cell. 2005 Nov;17(11):3176-3189.

    • Author

    • Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Göransson U, Craik DJ.