• DRAMP ID

    • DRAMP00927
    • Peptide Name

    • Cyclotide vico-A (Plant defensin)
    • Source

    • Viola cotyledon (Violeta)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
    • Sequence Length

    • 31
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00927 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00927.
    • Formula

    • C142H217N35O43S6
    • Absent Amino Acids

    • DHLMQRW
    • Common Amino Acids

    • C
    • Mass

    • 3294.85
    • PI

    • 7.76
    • Basic Residues

    • 2
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +1
    • Boman Index

    • -4.44
    • Hydrophobicity

    • 0.439
    • Aliphatic Index

    • 62.9
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 161.5
    • Polar Residues

    • 18

DRAMP00927

DRAMP00927 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism.
    • PTM

    • Problely contains three disulfide bonds 5-21; 9-23; 14-28. This is a cyclic peptide (cross-link at G1-N31).
  • ·Literature 1
    • Title

    • Expression of Viola cyclotides by liquid chromatography-mass spectrometry and tandem mass spectrometry sequencing of intercysteine loops after introduction of charges and cleavage sites by aminoethylation.
    • Reference

    • Anal Biochem. 2003 Jul 1;318(1):107-117.
    • Author

    • Göransson U, Broussalis AM, Claeson P.