General Information

    • DRAMP ID

    • DRAMP00927

    • Peptide Name

    • Cyclotide vico-A (Plant defensin)

    • Source

    • Viola cotyledon (Violeta)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00927 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00927.

Physicochemical Information

    • Formula

    • C142H217N35O43S6

    • Absent Amino Acids

    • DHLMQRW

    • Common Amino Acids

    • C

    • Mass

    • 3294.85

    • PI

    • 7.76

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +1

    • Boman Index

    • -4.44

    • Hydrophobicity

    • 0.439

    • Aliphatic Index

    • 62.9

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 161.5

    • Polar Residues

    • 18

DRAMP00927

DRAMP00927 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • Problely contains three disulfide bonds 5-21; 9-23; 14-28. This is a cyclic peptide (cross-link at G1-N31).

Literature Information

  • ·Literature 1

    • Title

    • Expression of Viola cyclotides by liquid chromatography-mass spectrometry and tandem mass spectrometry sequencing of intercysteine loops after introduction of charges and cleavage sites by aminoethylation.

    • Reference

    • Anal Biochem. 2003 Jul 1;318(1):107-117.

    • Author

    • Göransson U, Broussalis AM, Claeson P.