General Information

    • DRAMP ID

    • DRAMP00932

    • Peptide Name

    • Antimicrobial peptide 1 (PMAP1; Plant defensin)

    • Source

    • Pinus monticola (Western white pine) (Strobus monticola)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SYFSAWAGPGCNNHNARYSKCGCSNIGHNVHGGYEFVYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSNFGWKSVFIQC

    • Sequence Length

    • 79

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00932 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00932.

Physicochemical Information

    • Formula

    • C371H536N110O115S6

    • Absent Amino Acids

    • LM

    • Common Amino Acids

    • GNSA

    • Mass

    • 8569.36

    • PI

    • 8.6

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +6

    • Boman Index

    • -122.25

    • Hydrophobicity

    • -0.452

    • Aliphatic Index

    • 38.35

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18825

    • Absorbance 280nm

    • 241.35

    • Polar Residues

    • 41

DRAMP00932

DRAMP00932 chydropathy plot

Comments Information

    • Tissue specificity

    • Detected at higher levels in needles and twigs from canker-resistant seedlings than in needles from canker-susceptible plants. During summer, detected on cankered, healthy and marginal bark. During winter, detected at lower levels in cankered bark and bark from the canker margin than in healthy bark (at protein level).

    • Developmental stage

    • In summer, present at higher levels in older needles and twigs than in tissues from the current year. In winter, detected at high levels in both older and current-year needles and twigs. Induction

    • PTM

    • Problely contains three disulfide bonds 11-67; 21-79; 23-51.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and Characterization of a Putative Antifungal Peptide Gene (Pm-AMP1) in Pinus monticola.

    • Reference

    • Phytopathology. 2006 Feb;96(2):164-170.

    • Author

    • Ekramoddoullah AK, Liu JJ, Zamani A.
  • ·Literature 2

    • Title

    • Analysis of bark proteins in blister rust-resistant and susceptible western white pine (Pinus monticola).

    • Reference

    • Tree Physiol. 1997 Oct;17(10):663-669.

    • Author

    • Davidson J, Ekramoddoullah AK.