General Information

    • DRAMP ID

    • DRAMP00941

    • Peptide Name

    • Hellethionin-D (Plant defensin)

    • Source

    • Helleborus purpurascens (Purple hellebore)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • KSCCRNTLARNCYNACRFTGGSQPTCGILCDCIHVTTTTCPSSHPS

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00941 helical wheel diagram

    • PDB ID

    • 1NBL resolved by NMR.
  • 1NBL-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00941.

Physicochemical Information

    • Formula

    • C198H320N64O66S8

    • Absent Amino Acids

    • EMW

    • Common Amino Acids

    • C

    • Mass

    • 4909.59

    • PI

    • 8.53

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +5

    • Boman Index

    • -85.56

    • Hydrophobicity

    • -0.224

    • Aliphatic Index

    • 44.57

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 44.22

    • Polar Residues

    • 27

DRAMP00941

DRAMP00941 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Contains four disulfide bonds 3-40; 4-32; 12-30; 16-26.

Literature Information

  • ·Literature 1

    • Title

    • Structural characterization of hellethionins from Helleborus purpurascens.

    • Reference

    • Biochemistry. 2003 Mar 4;42(8):2404-2411.

    • Author

    • Milbradt AG, Kerek F, Moroder L, Renner C.