General Information

    • DRAMP ID

    • DRAMP00942

    • Peptide Name

    • Alpha-2-purothionin (Plant defensin)

    • Source

    • Triticum aestivum (Wheat)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI1.2

    • Sequence

    • KSCCRTTLGRNCYNLCRSRGAQKLCSTVCRCKLTSGLSCPKGFPK

    • Sequence Length

    • 45

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00942 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00942.

Physicochemical Information

    • Formula

    • C202H348N68O59S8

    • Absent Amino Acids

    • DEHIMW

    • Common Amino Acids

    • C

    • Mass

    • 4929.89

    • PI

    • 9.75

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +10

    • Boman Index

    • -101.16

    • Hydrophobicity

    • -0.391

    • Aliphatic Index

    • 52

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 45.23

    • Polar Residues

    • 24

DRAMP00942

DRAMP00942 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Problely contains four disulfide bonds 3-39; 5-31; 12-29; 16-25.

Literature Information

  • ·Literature 1

    • Title

    • cDNA cloning and nucleotide sequences of alpha 1 and alpha 2 thionins from hexaploid wheat endosperm.

    • Reference

    • Plant Physiol. 1994 Nov;106(3):1221-1222.

    • Author

    • Castagnaro A, Mara±a C, Carbonero P, Garc­a-Olmedo F.