General Information

    • DRAMP ID

    • DRAMP00944

    • Peptide Name

    • Purothionin A-1 (Plant defensin)

    • Source

    • Triticum aestivum (Wheat)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI1.3

    • Sequence

    • KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00944 helical wheel diagram

    • PDB ID

    • 1BHP resolved by X-ray.
  • 1BHP-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00944.

Physicochemical Information

    • Formula

    • C203H347N67O59S8

    • Absent Amino Acids

    • EHIMW

    • Common Amino Acids

    • C

    • Mass

    • 4926.88

    • PI

    • 9.54

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +9

    • Boman Index

    • -95.93

    • Hydrophobicity

    • -0.396

    • Aliphatic Index

    • 56.44

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 45.23

    • Polar Residues

    • 21

DRAMP00944

DRAMP00944 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

Literature Information

  • ·Literature 1

    • Title

    • Refinement of purothionins reveals solute particles important for lattice formation and toxicity. Part 2: structure of beta-purothionin at 1.7 A resolution.

    • Reference

    • Acta Crystallogr D Biol Crystallogr. 1995 Nov 1;51(Pt 6):914-924.

    • Author

    • Stec B, Rao U, Teeter MM.