General Information

    • DRAMP ID

    • DRAMP00945

    • Peptide Name

    • Phoratoxin (Plant defensin)

    • Source

    • Phoradendron tomentosum (California mistletoe)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00945 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00945.

Physicochemical Information

    • Formula

    • C203H329N65O63S6

    • Absent Amino Acids

    • EMQ

    • Common Amino Acids

    • CG

    • Mass

    • 4880.6

    • PI

    • 9.34

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +7

    • Boman Index

    • -84.28

    • Hydrophobicity

    • -0.407

    • Aliphatic Index

    • 44.57

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 163.67

    • Polar Residues

    • 26

DRAMP00945

DRAMP00945 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

    • PTM

    • Contains three disulfide bonds 3-40; 4-32; 16-26.

Literature Information

  • ·Literature 1

    • Title

    • Phoratoxin, a toxic protein from the mistletoe Pharoadendron tomentosum subsp. macrophyllum (Loranthaceae). The disulphide bonds.

    • Reference

    • Acta Pharm Suec. 1974 Sep;11(4):367-374.

    • Author

    • Mellstrand ST, Samuelsson G.