General Information

    • DRAMP ID

    • DRAMP00946

    • Peptide Name

    • Thionin-like protein 2 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • QKIPFKECYPACLVECKAGSKFPKYLKCPFTCTKECLQQPSPPSVSSNNIDESDYFCKLGCATYHCVSLSSIQNPNVERVSACVDSCSNKCTKKN

    • Sequence Length

    • 95

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00946 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00946.

Physicochemical Information

    • Formula

    • C453H715N121O142S12

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • CSK

    • Mass

    • 10513.11

    • PI

    • 8.46

    • Basic Residues

    • 13

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +5

    • Boman Index

    • -154.48

    • Hydrophobicity

    • -0.407

    • Aliphatic Index

    • 55.37

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6710

    • Absorbance 280nm

    • 71.38

    • Polar Residues

    • 40

DRAMP00946

DRAMP00946 chydropathy plot

Comments Information

    • Function

    • May be involved in plant defense.

Literature Information

  • ·Literature 1

    • Title

    • Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.

    • Reference

    • Nature. 2000 Dec 14;408(6814):816-820.

    • Author

    • Theologis A, Ecker JR, Palm CJ, et al.