General Information

    • DRAMP ID

    • DRAMP00947

    • Peptide Name

    • Denclatoxin-B (Plant defensin)

    • Source

    • Dendrophthora clavata (Columbian mistletoe)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGYRH

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00947 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00947.

Physicochemical Information

    • Formula

    • C203H333N65O59S6

    • Absent Amino Acids

    • DEFMW

    • Common Amino Acids

    • CP

    • Mass

    • 4820.64

    • PI

    • 9.38

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +7

    • Boman Index

    • -66.76

    • Hydrophobicity

    • -0.248

    • Aliphatic Index

    • 57.39

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 74.56

    • Polar Residues

    • 22

DRAMP00947

DRAMP00947 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Problely contains three disulfide bonds 3-40; 4-32; 16-26.

Literature Information

  • ·Literature 1

    • Title

    • Toxic proteins from the mistletoe Dendrophtora clavata. II. The amino acid sequence of denclatoxin B.

    • Reference

    • Acta Pharm Suec. 1977;14(3):245-254.

    • Author

    • Samuelsson G, Pettersson B.