General Information

    • DRAMP ID

    • DRAMP00949

    • Peptide Name

    • Ligatoxin-B (Plant defensin)

    • Source

    • Phoradendron liga (Argentine mistletoe)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • Human lymphoma cell line U-937-GTB (IC50=1.8 µM);##primary multidrug-resistant renal adenocarcinoma cell line ACHN (IC50=3.2 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00949 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00949.

Physicochemical Information

    • Formula

    • C194H319N63O67S6

    • Absent Amino Acids

    • EFMQ

    • Common Amino Acids

    • S

    • Mass

    • 4798.41

    • PI

    • 8.94

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -84.91

    • Hydrophobicity

    • -0.194

    • Aliphatic Index

    • 55.22

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 163.67

    • Polar Residues

    • 28

DRAMP00949

DRAMP00949 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Contains three disulfide bonds 3-40;4-32;16-26.

Literature Information

  • ·Literature 1

    • Title

    • Ligatoxin B, a new cytotoxic protein with a novel helix-turn-helix DNA-binding domain from the mistletoe Phoradendron liga.

    • Reference

    • Biochem J. 2002 Sep 1;366(Pt 2):405-413.

    • Author

    • Li SS, Gullbo J, Lindholm P, Larsson R, Thunberg E, Samuelsson G, Bohlin L, Claeson P.