• DRAMP ID

    • DRAMP00959
    • Peptide Name

    • Gamma1-purothionin (gamma1-P; thionin-like polypeptides; Plant defensin)
    • Source

    • Triticum turgidum L cv Senatore Capelli (wheat endosperm)
    • Family

    • Belongs to the thionin family
    • Gene

    • Not found
    • Sequence

    • KICRRRSAGFKGPCMSNKNCAQVCQQEQWQQQNCDQPFRRCKCIRQC
    • Sequence Length

    • 47
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Beta strand
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00959 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00959.
    • Formula

    • C227H372N82O66S9
    • Absent Amino Acids

    • HLTY
    • Common Amino Acids

    • Q
    • Mass

    • 5594.5
    • PI

    • 9.49
    • Basic Residues

    • 10
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +8
    • Boman Index

    • -163.57
    • Hydrophobicity

    • -1.145
    • Aliphatic Index

    • 27.02
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6000
    • Absorbance 280nm

    • 130.43
    • Polar Residues

    • 15

DRAMP00959

DRAMP00959 chydropathy plot
    • PTM

    • Contains four disulfide bonds.
  • ·Literature 1
    • Title

    • Gamma-purothionins: amino acid sequence of two polypeptides of a new family of thionins from wheat endosperm.
    • Reference

    • FEBS Lett 1990; 270: 191-194.
    • Author

    • Colilla FJ, Rocher A, Mensez E.