General Information

    • DRAMP ID

    • DRAMP00964

    • Peptide Name

    • Thionin (Plant defensin)

    • Source

    • Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI2

    • Sequence

    • KICCPRTIDRNIYNACRLTGASMTNCANLSGCKIVSGTTCPPGYTH

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00964 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00964.

Physicochemical Information

    • Formula

    • C203H335N63O64S7

    • Absent Amino Acids

    • EFQW

    • Common Amino Acids

    • CT

    • Mass

    • 4906.7

    • PI

    • 8.92

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -68.92

    • Hydrophobicity

    • -0.12

    • Aliphatic Index

    • 63.7

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 74.56

    • Polar Residues

    • 25

DRAMP00964

DRAMP00964 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and characterization of flower specific thionin in Chinese cabbage.

    • Reference

    • Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases

    • Author

    • Lee S.Y, Cho M.J, Choi Y.O.