General Information

    • DRAMP ID

    • DRAMP00965

    • Peptide Name

    • Probable leaf thionin (Plant defensin)

    • Source

    • Hordeum vulgare (Barley)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • KSCCKNTTGRNCYNACHFAGGSRPVCATACGCKIISGPTCPRDYPK

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00965 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00965.

Physicochemical Information

    • Formula

    • C199H320N64O61S8

    • Absent Amino Acids

    • ELMQW

    • Common Amino Acids

    • C

    • Mass

    • 4841.6

    • PI

    • 9.08

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -81.98

    • Hydrophobicity

    • -0.42

    • Aliphatic Index

    • 31.96

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 77.33

    • Polar Residues

    • 25

DRAMP00965

DRAMP00965 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Problely contains four disulfide bonds 3-40; 4-32; 12-30; 16-26.

Literature Information

  • ·Literature 1

    • Title

    • ORF of a leaf expressed barley thionin.

    • Reference

    • Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases

    • Author

    • Kah B, Kogel K.H, Langen G.