General Information

    • DRAMP ID

    • DRAMP00968

    • Peptide Name

    • Leaf-specific thionin BTH6 (Plant defensin)

    • Source

    • Hordeum vulgare (Barley)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • KSCCKDTLARNCYNTCRFAGGSRPVCAGACRCKIISGPKCPSDYPK

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Thievaliopsis paradoxa, Drechslera teres.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00968 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00968.

Physicochemical Information

    • Formula

    • C204H335N65O61S8

    • Absent Amino Acids

    • EHMQW

    • Common Amino Acids

    • C

    • Mass

    • 4930.78

    • PI

    • 9.22

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +7

    • Boman Index

    • -94.15

    • Hydrophobicity

    • -0.428

    • Aliphatic Index

    • 40.43

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 77.33

    • Polar Residues

    • 22

DRAMP00968

DRAMP00968 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Contains four disulfide bonds 3-40; 4-30; 12-26; 16-26.

Literature Information

  • ·Literature 1

    • Title

    • Leaf-specific thionins of barley-a novel class of cell wall proteins toxic to plant-pathogenic fungi and possibly involved in the defence mechanism of plants.

    • Reference

    • EMBO J. 1988 Jun;7(6):1559-1565.

    • Author

    • Bohlmann H, Clausen S, Behnke S, Giese H, Hiller C, Reimann-Philipp U, Schrader G, Barkholt V, Apel K.
  • ·Literature 2

    • Title

    • Specific and distinct expression patterns of two members of the thionin multigene family of barley in transgenic tobacco.

    • Reference

    • Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases

    • Author

    • Holtorf S, Schuetz C, Apel K, Bohlmann H.